SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465854|ref|YP_001040963.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465854|ref|YP_001040963.1|
Domain Number 1 Region: 62-101
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000236
Family Recombinase DNA-binding domain 0.039
Further Details:      
 
Weak hits

Sequence:  gi|126465854|ref|YP_001040963.1|
Domain Number - Region: 9-45
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0317
Family Recombinase DNA-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126465854|ref|YP_001040963.1|
Sequence length 106
Comment hypothetical protein Smar_0956 [Staphylothermus marinus F1]
Sequence
MNIEDLSKEKIEEIINDYKKGLPVKEIVKKHNIYLALLYEILRKYNIPLRKTEKQKMPTH
KRKKKSIIKKIVKMYRRGTSIYKISKQLGLPTSTVYYILKRQGLKK
Download sequence
Identical sequences A3DN45
gi|126465854|ref|YP_001040963.1| WP_011839246.1.69113 399550.Smar_0956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]