SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113968850|ref|YP_732643.1| from Shewanella sp. MR-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113968850|ref|YP_732643.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 3.92e-123
Family UbiD middle domain-like 0.000000000298
Further Details:      
 
Domain Number 2 Region: 323-487
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 3.79e-68
Family UbiD C-terminal domain-like 0.0000000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113968850|ref|YP_732643.1|
Sequence length 493
Comment 3-octaprenyl-4hydroxybenzoate decarboxylase [Shewanella sp. MR-4]
Sequence
MSFKDLRSFIDHLEANGELKRISYPVDPHLEMTEIADRVLRAKGPALLFENPTNHSMPVL
ANLFGTPKRVAMALGKEDPLALRDVGELLAFLKEPEPPRGFKDAISKIPMFKQALNMPPK
TVRNPACQQVVKTGDEVDLTQLPIQHCWPGDVAPLVTWGLTITKGPRKSRQNLGIYRQQL
LGKNKLIMRWLSHRGGALDFADFKEQFPGERYPVVVALGSDPVTILGAVTPVPDAMSEYA
FAGLLRGERTEVCKALSCDLEVPASSEIILEGYIDPDEMAEEGPYGDHTGYYNETDKFPV
FTVTHITHRKDPIYHSTYTGRPPDEPAMLGVALNEVFVPILRKQYPEIIDFYLPPEGCSY
RMAVISIRKQYPGHAKRVMMGAWSFLRQFMYTKFIVVVDDDVNCRDWNDVIWAITTRMDP
KRDTVMIDNTPIDYLDFASPVAGLGSKMGLDATNKREGETNREWGTPIVMDPKVKQKIDS
IWDELGIDDSPTL
Download sequence
Identical sequences Q0HMY1
60480.Shewmr4_0506 WP_011621308.1.3791 gi|113968850|ref|YP_732643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]