SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113970093|ref|YP_733886.1| from Shewanella sp. MR-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113970093|ref|YP_733886.1|
Domain Number 1 Region: 446-538
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000175
Family Anti-sigma factor antagonist SpoIIaa 0.0095
Further Details:      
 
Weak hits

Sequence:  gi|113970093|ref|YP_733886.1|
Domain Number - Region: 343-401
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0959
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113970093|ref|YP_733886.1|
Sequence length 585
Comment sulfate transporter [Shewanella sp. MR-4]
Sequence
MKFPSLVSLMPGLAQMLQYEKQWIRDDVRAGLSVAAVALPVAIAYAQLTGVNAAVGLYSC
VLPMLVYALFGTSRQLIVGPDAATCAVIAAVVTPLAAGDSMKHWQLVMTMTAMTGFWCLI
ASRFRLGVLADFLSKPILMGLLNGVAITIIVGQFSKIFGFTFDERYLIERLTGAPSYLTK
THWPTLLMGVVTLATYALVKRYRPLWPASMCAMAMAAFLVWAFNLTSFDINVVGEVSAGL
PSFQAPAFDLGIARELVVPALNLAMVSFVSMMLTARSFAAKNGYDIDADKEFRALGIANI
ASALSQGFAVSGADSRTAVNDANGGKSQLVSIIAAVLIALVALFFTAPLKYIPSSALGVV
LVIASISLIDLKALWNLRVRDRSAFLLACTTLFSVLFIGVIPGITLAVLLGLFQFLATVM
RPTDQVLGLDQKGVIRSVDDSGKAKSVPGVFIYRFNSPLTYFNATYFKRRLLEKFIREPE
PVDCIIIDAVPCFTHLDLSVMAMLADLHQLLKKRGIRLVLAGRKRQMLGWFEQAGMQSGE
GGILIRPDLYLALKMNQSYKQALAEGQAPVIKKAPEDDVLLHSHL
Download sequence
Identical sequences WP_011622526.1.3791 60480.Shewmr4_1755 gi|113970093|ref|YP_733886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]