SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150006747|ref|YP_001301490.1| from Parabacteroides distasonis ATCC 8503

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150006747|ref|YP_001301490.1|
Domain Number 1 Region: 386-599
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.83e-28
Family ABC transporter ATPase domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 126-383
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.49e-17
Family DNA repair protein MutS, domain III 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150006747|ref|YP_001301490.1|
Sequence length 602
Comment DNA mismatch repair protein MutS [Parabacteroides distasonis ATCC 8503]
Sequence
MEEIYSYYKENIDAYTRRLGNLKKNIHLMGSIRLALVVGAILSLWIFRDESWQWLTGITF
AYIIPFALLMWYHNKMYARKVYAETLIKLNEDELKGLDYDFSAFDGAADKISGEHSFCLD
LDVFGDRSLFQSLNRTVTGFGRERLAGWLSNPLTDKKEIVKRQEAVKELATLSALRQHFY
VTGIIRQDTQDTRDNDINFMDRLTQRKHKFVDSLPWKLLIWAVPVLWIVLGIAYSLDWIS
GSLLNIYFLITLVIAYGRAKEINALYATVNKMESIFNRYSKLMQCVEEDNFQSEELKEIS
GQLANEKELASHAIKRLSSYIGGLDQRFSLAGIIFNLFYLRDTRHAILLERWIQTYSDKL
PLWFDALARFDALNSLGGFAFNHPEYIYPEIADTYFQMEGKALGHPLLNREVCVKNDIDI
RKSPWFLIITGANMAGKSTYLRTIGVNYLLACVGAPVCAASLTVYPAHMVTSLRTSDSLA
SNESYFFAELKRLKMIIDRLQNGEKLFIILDEILKGTNSIDKQKGSLALMKQLVAYKACG
IIATHDLVLGTLEEEFPEQIKNYRFEADIKDEELSFSYQLREGIAQNMNACFLMNKMGIL
FN
Download sequence
Identical sequences A0A2J9HW84 A6L854
435591.BDI_0073 gi|150006747|ref|YP_001301490.1| WP_011965879.1.47855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]