SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150007180|ref|YP_001301923.1| from Parabacteroides distasonis ATCC 8503

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150007180|ref|YP_001301923.1|
Domain Number 1 Region: 29-213
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.49e-21
Family Crotonase-like 0.086
Further Details:      
 
Domain Number 2 Region: 402-456
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000876
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150007180|ref|YP_001301923.1|
Sequence length 459
Comment membrane-bound serine protease [Parabacteroides distasonis ATCC 8503]
Sequence
MKRLLTILTAIVLILAISLQSEAKEKSLIYTIDIKKEIDNTTWIYLHNGLSEAKQLNADA
ILLHMNTYGGLLESADSMRTAILYSPIPVYVFIDNNAASAGALISIACKKIYMRKGANIG
AATVVNQTGAALPDKYQSYMRSMIRSTAEAQGKDTLIQNGDTIYKWKRDPLIAEAMVDDR
VIVPNLIDSGKVLTLTSQEALKWGYCDGIAESPDQVITEYIGCKDYEIKSYEPSWFDNVK
GFFMSPVIQSLLIIIIIGGIYFEMQTPGLGFPSAAAIIAAILYFAPLYMDGLAENWEILL
FILGVILIMLEIFVIPGFGIAGISGIILVVGGLTMSLLNNTVFDFQNVSGMDTGRAALTV
LLGLGIGFTLVIWLSNKIGHKGPLKKMALNADLEKAVSSPNLTQLIGKEGTAATVLRPSG
KVSIEGELYDGVSESGFIEKGTPIKVVRFESAQVYVINL
Download sequence
Identical sequences A0A078SWR8 A0A174LKC6 A0A223HNP1 A6L9D7 D7IWG8 K6AGA3
435591.BDI_0525 WP_005855684.1.12386 WP_005855684.1.29417 WP_005855684.1.47855 WP_005855684.1.52717 WP_005855684.1.56575 WP_005855684.1.61673 WP_005855684.1.86952 WP_005855684.1.88644 WP_005855684.1.98975 gi|150007180|ref|YP_001301923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]