SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150009091|ref|YP_001303834.1| from Parabacteroides distasonis ATCC 8503

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150009091|ref|YP_001303834.1|
Domain Number 1 Region: 218-605
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.38e-72
Family beta-Lactamase/D-ala carboxypeptidase 0.00075
Further Details:      
 
Domain Number 2 Region: 64-261
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.53e-17
Family Penicillin binding protein dimerisation domain 0.0082
Further Details:      
 
Domain Number 3 Region: 678-730
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000484
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150009091|ref|YP_001303834.1|
Sequence length 731
Comment penicillin-binding protein [Parabacteroides distasonis ATCC 8503]
Sequence
MSEENEPKEIEPKGSRILFCYFVVVLLLGLVAVGILFRAFDTAFVERDKWMKVAESQKRP
NRLVLPGRGNIYSSDGKLMATSVPRYYMYIDFKADAYTPAKGAKYNWLDTFKTSKKDGVD
SLAFYLSRKLKDRTPAGYKAYLLKGLSGKSRQFPIYAGKVSYSDLKEIRKFPFLRLGRYK
SGFYTKEMVQRQKPFGTLASRTIGDIYGEIEEGGTTKGKNGLELQYDSLLRGQAGLSSVR
RVGGGWTNVIEVDPVDGMDIRTTIDINIQDITEKSLVDKLKAIDAESGTAVVMEVETGEI
KAITNMGRIREGVYGETKNHAVADEIEPGSTFKVASIMVALEDGLCNPGDTVDVGNGIYM
YKGARMTDHNMNKGGYGRISVEQAIWYSSNIGVAKTILKGYSDNPTKFVEGLYRIGMNAD
LRLEIPGAGRAKIRRPDDTTRYWSKTTLPWMSFGYETQVPPINTLAFFNAIANNGKMVRP
MFTKEILHNGKTVQSFSTEVINSSICSDHTLALIKDMLLGVVEKGTGKAVHSDIVRIAGK
TGTAQIATGGVYRTSGHQVSFCGYFPADHPKYSCIVVIRRPRIGYPSGGTMSGGVVRAIA
EKIYASHMSFDVRDMERDSMAVMVPRVKGGDLRAVEEVLDELDIKADTDSLETKWVVASA
EQEENKVKLSDLTIREGLVPRVVGMGAKDAVFLLEQAGLRVSLSGVGRVVSQSIQPGQRV
SKGQTVLLTLK
Download sequence
Identical sequences A0A2J9HS74 A6LEU8
435591.BDI_2492 gi|150009091|ref|YP_001303834.1| WP_011966871.1.47855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]