SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150009275|ref|YP_001304018.1| from Parabacteroides distasonis ATCC 8503

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150009275|ref|YP_001304018.1|
Domain Number 1 Region: 45-107
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000536
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150009275|ref|YP_001304018.1|
Sequence length 208
Comment hypothetical protein BDI_2677 [Parabacteroides distasonis ATCC 8503]
Sequence
MSNFFVKLIKNPFVINLLLVIVVSCGVVYGVLAWLDSYTRHNQAVVVPDVKGMKLEDAAE
FFGNNKLRYNVIDSVFSKDVAPGSIVELVPGVGSKVKEGRIVFVTINALTSQMAVIPEVE
DLSFRQAYALLRARGFSSVEIEYVPGDYKDLAMGVELNGRTLLKGEHVPLTAHLVLKVSS
GDPNMLPDSLALDSIPVEPLDSDIENWF
Download sequence
Identical sequences A0A069S714 A0A073I4E9 A0A078TMI3 A0A0J9DFE2 A0A174K055 A0A1Q6FMN8 A0A223HSH1 A6LFD2 D0TFW8 D7IUK3 E1YXT6 K5ZBR5 K6BEL6
435591.BDI_2677 gi|150009275|ref|YP_001304018.1| WP_005861027.1.12386 WP_005861027.1.27322 WP_005861027.1.29417 WP_005861027.1.34635 WP_005861027.1.38556 WP_005861027.1.40665 WP_005861027.1.47855 WP_005861027.1.52717 WP_005861027.1.56575 WP_005861027.1.61673 WP_005861027.1.72038 WP_005861027.1.725 WP_005861027.1.76859 WP_005861027.1.80225 WP_005861027.1.86952 WP_005861027.1.88644 WP_005861027.1.88798 WP_005861027.1.90444 WP_005861027.1.94048 WP_005861027.1.98975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]