SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150009585|ref|YP_001304328.1| from Parabacteroides distasonis ATCC 8503

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150009585|ref|YP_001304328.1|
Domain Number 1 Region: 267-563
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.02e-83
Family DNA repair protein MutS, domain III 0.00000107
Further Details:      
 
Domain Number 2 Region: 566-802
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.45e-58
Family ABC transporter ATPase domain-like 0.00000107
Further Details:      
 
Domain Number 3 Region: 7-112
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.44e-39
Family DNA repair protein MutS, domain I 0.0000512
Further Details:      
 
Domain Number 4 Region: 113-266
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 7.98e-39
Family DNA repair protein MutS, domain II 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150009585|ref|YP_001304328.1|
Sequence length 870
Comment DNA mismatch repair protein MutS [Parabacteroides distasonis ATCC 8503]
Sequence
MAKVVETPLMKQYFDIKAKHPDAILLFRVGDFYEMYGEDAVIGAEILGIVQTKRANGVGQ
HVEMAGFPHHALDSYLPKLVRAGKRVAICDQLEDPKLTKKLVKRGITELVTPGVSINDNI
LNHKENNFLASIHFAKEVCGISFLDISTGEFMTAEGSIDYIDKLLNNFSPKEVLIERGNK
KRFEEAFGPRFFIFELDDWIFTTSAAEDRLLKHFETKNLKGFGVQHLKLGIIASGAILYY
LDQTQHTHISHITALSRIEEDRYVRLDKFTVRSLELVGTMNDEGTSLLDVIDKTISPMGS
RMLRRWILFPLKDVKPIQERQEVVDYFFREPETKELLDTQLEQIGDLERIISKVAVGRVS
PREVVQLKVALRAIEPIKEACMASGEPSLCRIGEQLNACALIRDRIEKEINNDPPSLVNK
GGIIAKGVNEELDDLRAIAYSGKDYLLKVQQREIELTGIPSLKIAFNNVFGYYIEVRNTH
KDKVPANWIRKQTLVNAERYITEELKEYEEKILGAEEKILALETRLFNELVLALTEYIPP
IQMNANLIGRIDCLLSFAKAAEANKYIRPVVSDSDKIDIKGGRHPVIEKQLPLGEPYIAN
DVYLDDEKQQIIIITGPNMAGKSALLRQTALITLMAQIGCFVPAESAHIGIVDKIFTRVG
ASDNISVGESTFMVEMNEASDILNNMTSRSLVLFDELGRGTSTYDGISIAWAIVEYIHEH
PNAKAKTLFATHYHELNEMERAFKRIKNYNVSVKEVGNKVIFLRKLIPGGSEHSFGIHVA
KMAGMPKSIVKRSNEILKQLESENRQEGITGKPVKAIASAAEGYQLSFFQLDDPVLSQVR
DEIKNLDVNNLTPLEALNKLIEIKRIITGK
Download sequence
Identical sequences A0A2J9HTG2 A6LG92
435591.BDI_2998 WP_011967099.1.47855 gi|150009585|ref|YP_001304328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]