SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952715|ref|YP_729323.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952715|ref|YP_729323.1|
Domain Number 1 Region: 5-231,363-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.01e-80
Family Tandem AAA-ATPase domain 0.000000154
Further Details:      
 
Domain Number 2 Region: 727-941
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.11e-70
Family Helical scaffold and wing domains of SecA 0.0000109
Further Details:      
 
Domain Number 3 Region: 413-520,616-725
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.91e-50
Family Tandem AAA-ATPase domain 0.00000762
Further Details:      
 
Domain Number 4 Region: 230-363
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 4.32e-40
Family Pre-protein crosslinking domain of SecA 0.0000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113952715|ref|YP_729323.1|
Sequence length 950
Comment preprotein translocase subunit SecA [Synechococcus sp. CC9311]
Sequence
MLKLLLGDPNARKLKRYQPIVSDINLLEEEIEPLSDDDLRRRTAEFRQRLEAAGSLDKQR
PLLDDLLPEAFAVVREAGKRVLGMRHFDVQMIGGMVLHEGQIAEMKTGEGKTLVATLPSY
LNALTGRGVHVVTVNDYLARRDAEWMGQVHRFLGLSVGLIQQDMTPAERRINYGCDITYA
TNSELGFDYLRDNMAADINEVVQREFQFCVIDEVDSILIDEARTPLIISGQVERPQEKYE
KAAEVANALERAAEMGKDGIDPEGDYEVDEKQRSSTLTDEGFTKAEALIGVADLYNPQDP
WAHYITNALKAKELFVRDVNYIVRDGEAVIVDEFTGRVMPGRRWSDGQHQAIEAKEGLAI
QPETQTLASITYQNFFLLYPRLAGMTGTAKTEEVEFEKTYSLQTAIVPTNRVRARQDWVD
QVYKTETAKWRAVAKETAEVHKQGRPVLVGTTSVEKSELLSALLAEENIPHNLLNAKPEN
VEREAEIVAQAGRAGSVTIATNMAGRGTDIILGGNSDYMARLKLREVLLPRLVRPEDDHR
PPVPLQRSEEGGGGFSATAPASGPHGNAPSEAKAIGNLYPCQLTEETDQALVELAKQLVK
AWGDRALSVIELEDRIATAAEKAPTEDPEIAQLRASIAQVKGEYDAVVKQEEMGVREAGG
LHVIGTERHESRRVDNQLRGRAGRQGDPGSTRFFLSLGDNLLRIFGGERVAGLMNAFRVE
EDMPIESGMLTRSLEGAQKKVETYYYDIRKQVFEYDEVMNNQRKAVYTERRRVLDGRELK
KQVIGYGERTMNEIVEAYVNPDLPPEEWDVSQLVSKVKEFVYLLEDLQPDQLQGLSMDDL
KAFLQEQLRNAYDLKEGEIEELRPGLMREAERFFILQQIDTLWREHLQAMDALRESVGLR
GYGQKDPLIEYKNEGYDMFLEMMTNMRRNVIYSMFMFRPAPPAAAQATTA
Download sequence
Identical sequences Q0IDZ9
64471.sync_0086 gi|113952715|ref|YP_729323.1| WP_011618073.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]