SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952774|ref|YP_731371.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952774|ref|YP_731371.1|
Domain Number 1 Region: 217-333
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 1.7e-28
Family DRTGG domain 0.00051
Further Details:      
 
Domain Number 2 Region: 1-228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-24
Family Nitrogenase iron protein-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113952774|ref|YP_731371.1|
Sequence length 360
Comment phosphotransacetylase domain-containing protein [Synechococcus sp. CC9311]
Sequence
MGNTLLIGSCEPFSGKSALVLGLARHLQSEGQTVRFGKPLATSLEWTAKGSPLPDPLIDD
DVRFVGTTLGLDETRLIPSLHLLSPETADTRLRQGNLEAGTGLEMLLKDLQNDQDSFTML
EAAGSLHEGLMYGLSLVQLAQGLDAPVILVHLWQDSRSVDALLAAQHQLGDRLAGVVLNA
VTPDEVEELNQHVVPALQALGLEVFGVMPRSPLLRSVTVGELVRRLDARVICCKERLELL
VETLSIGAMNVNSAMEFFRRRRNMAVVTGADRTDIQLAALEASTQCLILTGAGEPLPQLV
NRADELEVPLLKVEHDTLATVEVIEQAFGHVRLHETVKATYAFRLVEEHCHLSELFRAIS
Download sequence
Identical sequences Q0I851
64471.sync_2172 gi|113952774|ref|YP_731371.1| WP_011620083.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]