SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952781|ref|YP_729511.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952781|ref|YP_729511.1|
Domain Number 1 Region: 7-191
Classification Level Classification E-value
Superfamily Folate-binding domain 1.26e-28
Family Aminomethyltransferase folate-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113952781|ref|YP_729511.1|
Sequence length 284
Comment glycine cleavage system protein T [Synechococcus sp. CC9311]
Sequence
MSQLLWDHNFPVLRLEGSGSRTFLQGQTSADVQQAEEGDLLPACWLDATGRVQALLEIRM
DATGADVLVLAGAVDAVSQGFDRVIFPADRVRLKGIRQQRRQELLVQAQPMEPVNVFWTE
DEPSASDRFPASEAANATQLDRWRIGQGWPLSAGELDGTTNPFELGLSPWVHLNKGCYLG
QETVAKLASKGEVKQQLRSWRAFSSELQGTVPQRGTVLRRQGERAGVITSALEIASAEGL
PQEWIGLALVRRQALADPQLSLDNDQGSIQLFKPQAFSEPPKRV
Download sequence
Identical sequences Q0IDG1
64471.sync_0275 WP_011618256.1.57161 gi|113952781|ref|YP_729511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]