SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952790|ref|YP_730422.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952790|ref|YP_730422.1|
Domain Number 1 Region: 170-215
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000000994
Family GSPII protein E N-terminal domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113952790|ref|YP_730422.1|
Sequence length 233
Comment hypothetical protein sync_1213 [Synechococcus sp. CC9311]
Sequence
MSIYCIFKINTVSVKLLLKSDVTRVEVLGQGNTFPLNFSIIAPFTETSFVEELIIQKFGT
TRLDPNQLFTFLSSDPLVQSKFDGPEIISGSLSNENHINQSVDFNSQALGRKLVLCGLLS
DQDLDELLDRFQPFSNTQRFGEFLRLNLNIPFQILDFFLTKSLANLDFNSLKLGERLVSL
GLVSQSSIDQALERQSISGGRIGDILVSNNDINPQLTDFFAQLRLNESGMFVI
Download sequence
Identical sequences Q0IAV0
WP_011619143.1.57161 gi|113952790|ref|YP_730422.1| 64471.sync_1213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]