SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952806|ref|YP_731202.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952806|ref|YP_731202.1|
Domain Number 1 Region: 374-572
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.08e-66
Family Pyruvate oxidase and decarboxylase PP module 0.0000147
Further Details:      
 
Domain Number 2 Region: 5-185
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.9e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000034
Further Details:      
 
Domain Number 3 Region: 199-367
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 6.55e-62
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113952806|ref|YP_731202.1|
Sequence length 581
Comment acetolactate synthase 3 catalytic subunit [Synechococcus sp. CC9311]
Sequence
MDWNGQRRITGAHALMNALRLHGVDTIFGYPGGAILPIYDALHIAESEGWLKHILVRHEQ
GGTHAADAYARATGRVGVCFGTSGPGATNLVTGIATAQMDSVPMVVITGQVPRPAIGTDA
FQETDIFGITLPIVKHSWVVRDPADLASVVAQAFLIASSGRPGPVLIDIPKDVGQEEFDY
VPVQPGSIQPPGFRQPAKPAVQEVIDALALMRKSSRPLFYVGGGAVSAGAHDSLRILAER
FQIPVTTTLMGKGAFDENHPLALGMLGMHGTAYANFAVTDCDLLIAVGARFDDRVTGKLD
TFAPKAKVIHFEIDPAEVGKNRCPDVVVLGDVGLSLAQLVDQSRPHSAELTTSSWLEQIN
SWKELYPLTIPAKEGAIFPQEVLLAVRDLASDAIITTDVGQHQMWAAQYLRNRPRCWISS
AGLGTMGFGMPAALGAQVAFPDQKVVCIAGDASILMNIQELGTLAQYSLPVKVVIVNNHW
QGMVRQWQESFYDERYSASDMLNGMPDFSALARAFGVDGVKITERDDLHSKLSEAFASPR
PTLIDVHVRRGENCYPMVPPGASNAQMVGLPSHPELAQDSR
Download sequence
Identical sequences Q0I8M0
gi|113952806|ref|YP_731202.1| 64471.sync_1999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]