SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952820|ref|YP_731833.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113952820|ref|YP_731833.1|
Domain Number - Region: 81-143
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0863
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113952820|ref|YP_731833.1|
Sequence length 252
Comment hypothetical protein sync_2645 [Synechococcus sp. CC9311]
Sequence
MSDTTESSRLQVLQAIEDGWSGFAKAPLPFVLFTLLSGALGLIFQVISHSAAMRSSAGSG
FDPGTVLLMIISVIGSTVISLWAVTGLIRGAWKALSGHKPSFGDLTRWDGQAAGRLFINQ
LVLAIVLVIILFIAVAIGTGLFQINQALAVIPGLVAGIVFLYLGVNQKFLPFIAIAEEGN
PLQKIQRGRAVVDPSWWWMLLLLIVEVVILGIGLLLNGVGLLVASPLVICISTAAYRQLF
GTEDQTGFLSEN
Download sequence
Identical sequences Q0I6T9
gi|113952820|ref|YP_731833.1| 64471.sync_2645 WP_011620537.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]