SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952854|ref|YP_730932.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952854|ref|YP_730932.1|
Domain Number 1 Region: 70-194
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 1.27e-29
Family L,D-transpeptidase catalytic domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113952854|ref|YP_730932.1|
Sequence length 197
Comment ATP synthase [Synechococcus sp. CC9311]
Sequence
MELLTGLLARCADHWLVIKRAETVAPYFNESKYAQFCLRRMSNSWIRRVAVCIGLAVVAS
ATQLPARAEKTIEISLKDRYLKLLDSGVVVARYPVAIGAPESPTPAGSYEITRMEDAPVY
HKKGKVIAPGPKNPVGVRYMAYFQLGSGEYAIHGTAWPNWVNLRAAVSLGCIRMLNKDVI
SLFNQVDVGTPVVVTSK
Download sequence
Identical sequences Q0I9E0
gi|113952854|ref|YP_730932.1| 64471.sync_1728 WP_011619645.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]