SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952885|ref|YP_729639.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952885|ref|YP_729639.1|
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily L28p-like 1.77e-24
Family Ribosomal protein L31p 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113952885|ref|YP_729639.1|
Sequence length 88
Comment 50S ribosomal protein L31 [Synechococcus sp. CC9311]
Sequence
MPKPDIHPTWYPDAKVICNGEVVMTTGSTQPEINVDVWSGNHPFFTGTQKILDTEGRVDR
FMRKYGMGSVDNATSEKKSATDETSKES
Download sequence
Identical sequences Q0ID33
64471.sync_0409 gi|113952885|ref|YP_729639.1| WP_011618377.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]