SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952909|ref|YP_730901.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113952909|ref|YP_730901.1|
Domain Number - Region: 121-200
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.000785
Family L,D-transpeptidase catalytic domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113952909|ref|YP_730901.1|
Sequence length 210
Comment hypothetical protein sync_1697 [Synechococcus sp. CC9311]
Sequence
MVWSAPFQLLASRATPCMLLLSAVCAGHEFSAPSQANDFVLNSPQPVEVSSRLLAILEPP
IAIPDPEPQLVLNRTKRQIRSTGDPIWDLRLEIPGQPSRHFDAVSGRAHRQNADRDQMGS
KAPLPTGSYTLGPVEPLAKGAYPELGPVWIGIEPTFTTGRRVLGIHQDPSAGLNGNSGTL
GCIGLIREHDLIELSQLIQVSDVRLLVVED
Download sequence
Identical sequences Q0I9H1
WP_011619615.1.57161 64471.sync_1697 gi|113952909|ref|YP_730901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]