SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113952990|ref|YP_730715.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113952990|ref|YP_730715.1|
Domain Number 1 Region: 803-1028
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.22e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.00025
Further Details:      
 
Domain Number 2 Region: 301-505
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.06e-42
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000842
Further Details:      
 
Domain Number 3 Region: 46-135
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.07e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0019
Further Details:      
 
Domain Number 4 Region: 153-191,277-327
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000000889
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.013
Further Details:      
 
Domain Number 5 Region: 719-804
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000262
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0083
Further Details:      
 
Domain Number 6 Region: 192-274
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000034
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113952990|ref|YP_730715.1|
Sequence length 1034
Comment cation efflux system protein czcA-1 [Synechococcus sp. CC9311]
Sequence
MLNKLLNAILRGSIARRWLVVLCSLVISVWGVLNVVQMPLDVFPPFAPPQVEIQTAAPGL
TPEQVERQISEPIEAAVNGLPGVNVVRSASKPGLSMVQVVFRDASKLQSARQLVSERLQQ
VLPQLPTTADAPEISPPLSPLGTVLQYAFTLPESAPTDQQFQLRSLVQTTYENALLAIPG
VAQVTIYGGDLPETQVQLNLKALLQQNLALSDVVEATRDAQFKGRGGVQIAGGQERLILP
PTSSTASADLERAAMSSSTGQIIALGDVAEIRPGAAMRRGEATFNAKPAVVLMINKQPDV
DTPRLTKAVEERVKQLNASLPKDVVVTQSFRQAEFIDIAIRNVSESLLLGVVIVAAVLLL
FLMNWRTAVITLSAIPLSLLVGLLLMRGLGLQLNTMTLGGLVVAIGSVVDDAIVDMENCY
RGLRRNKQLPSPQNPLEVVFRTSVEVRQPVLFSTLIIVVVFAPVFTLTGVEGRIFMPMGI
AYVLSIVASTLVALTLSPALCALLLSRTPLPVDNSWVERSAERLYKPILNLALTTPRRVL
ALALASVVAAVLILPGLGRVFLPEFREQALLNSMVLYPGVSLEMTSRAGTVLSERLQSSD
DVDWIQVRSGRAPGDADGAGVNIAHVDLELSDQAMADRTSAIARIRKAFLALPGVAPNIG
GFISHRMDEVLSGVRSAIAIKISGPDLNELRRLGEQVRDVVGEVSGVVDLQLEPQLPVPQ
LQLRIDRELALQEGVSVATLAQASEVALHGALISPAESASGRNAVVVTLPPEQRSNLNAL
RRVPIRTASGALKPLGDFVMVESTHGPNEIYREDVARRIVVSANVAERPLGSVVNNIRSL
VDKSVTLPAGYTIRYGGQFESEQRATRALLIYSVLAAVVIAFLMVIAVRSWPATAAILVN
LPLALVGGLVAVLLSGGVLSVASLIGFITLFGVAVRNGLLLVDNFNRRHQSGEPLMELIR
NGSLERLNAILMTALTSSLGMLPLALAFGAGNEILQPLAIVVLGGLITSTLLTLVVIPAL
YARYGRWLLHASTR
Download sequence
Identical sequences Q0IA07
WP_011619432.1.57161 64471.sync_1510 gi|113952990|ref|YP_730715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]