SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953085|ref|YP_731916.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953085|ref|YP_731916.1|
Domain Number 1 Region: 9-129
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 9.55e-30
Family N-utilization substance G protein NusG, N-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 116-190
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.25e-16
Family N-utilization substance G protein NusG, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953085|ref|YP_731916.1|
Sequence length 192
Comment transcription antitermination protein NusG [Synechococcus sp. CC9311]
Sequence
MPARTSVARWYAVQVASSCEKKVKATLEQRAVTLGVSNRILEIEIPETPAVKVKKDGSRQ
STEEKVFPGYVLVRMVLDEDTMMAVRSTPNVINFVGAEDRRATGKARGHIKPRPLSRQEV
DRIFKRAAEKKTVVKVDLAEGDQILVTAGPFKDFQGEVIEVSGERSKLKALLSIFGRETP
VELEFSQISKQN
Download sequence
Identical sequences Q0I6K6
64471.sync_2728 gi|113953085|ref|YP_731916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]