SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953175|ref|YP_730799.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953175|ref|YP_730799.1|
Domain Number 1 Region: 5-272
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.58e-60
Family rRNA adenine dimethylase-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113953175|ref|YP_730799.1|
Sequence length 277
Comment dimethyladenosine transferase [Synechococcus sp. CC9311]
Sequence
MTFSGHTARKRFGQHWLINERVLDRIVEAAELQDGDRVLEVGPGRGALTERLLASAAAAI
HAVELDRDLVAGLQQTFASHPKFSLQEGDVLSVPLELSGGVPANKVVANIPYNITGPLLD
RLIGRLDRPVDFSYQRLVLLVQHEVAQRIRARPGHSNFSALSVRMQLLGRCSHVCPVPPR
CFQPPPKVQSEVICIDPFPPERRPTAALSRGVERLLKMAFLSRRKMLRNTLAPVGSTDLL
QSLAEEAGISLQQRPQDVAPEAWVALAKGLNQVDSVA
Download sequence
Identical sequences Q0I9S3
64471.sync_1594 WP_011619516.1.57161 gi|113953175|ref|YP_730799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]