SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953218|ref|YP_730605.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953218|ref|YP_730605.1|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 5.69e-25
Family Ribosomal protein L28 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953218|ref|YP_730605.1|
Sequence length 78
Comment 50S ribosomal protein L28 [Synechococcus sp. CC9311]
Sequence
MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGKRWINLRITTRALKTIQ
KKGLGAYARSLGINLAKL
Download sequence
Identical sequences A0A2H4P0X6 G4FKC1 Q0IAB7
gi|113953218|ref|YP_730605.1| WP_006852613.1.44266 WP_006852613.1.57161 64471.sync_1399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]