SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953232|ref|YP_729655.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953232|ref|YP_729655.1|
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily RL5-like 3.53e-73
Family Ribosomal protein L5 0.000000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113953232|ref|YP_729655.1|
Sequence length 179
Comment 50S ribosomal protein L5 [Synechococcus sp. CC9311]
Sequence
MSLKQRYRETIQPKLLKDLSLSNIHEVPKVLKVTVNRGLGEAATNAKSLEASVNELAQIT
GQKVVITRAKKAIAAFKIRQGMPIGCAVTLRGDRMYAFLERFINLALPRIRDFRGVSPKS
FDGRGNYTVGVREQIIFPEISFDKIDAIRGMDITIVTSARTDEEGRALLREMGMPFRSN
Download sequence
Identical sequences A0A0H4BI67 A0A2H4P2T0 A0A2H4P2T8 A0A2H4P2U9 G4FPS9 Q0ID17
64471.sync_0425 WP_006854816.1.28265 WP_006854816.1.44266 WP_006854816.1.57161 gi|113953232|ref|YP_729655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]