SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953241|ref|YP_729636.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953241|ref|YP_729636.1|
Domain Number 1 Region: 31-266
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.16e-61
Family Alanine racemase-like, N-terminal domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 260-392
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.49e-44
Family Alanine racemase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953241|ref|YP_729636.1|
Sequence length 393
Comment alanine racemase [Synechococcus sp. CC9311]
Sequence
MRDQIADDRNAPWILNPVEANPRQRAWLEVSDSAIEANARSLKRHLGPHCDLMAVVKADG
YGHGAETVAKASVRGGATSFGVATLQEGIDLRNAGLDQPVLVLGHLSQPDDLRACLQWRL
MPTLSSMREALLCQNLADSSGRRFPVQLKVDTGMTRLGCDWKDGKRLAHAIQQLDQLSLS
GIYSHLALADGERDGPAAQVTKLQEDRFESITRELRSPTLKRHLANSAGTLRDTGLHHDL
VRVGLALYGHCPSEHLDGILNLEPAMSVKAKVSLIREVPAGVGVSYGHRFVTQRPSRLAV
VSIGYADGVSRCLSGRIHALHAGQTLPQVGAITMDQLILDATEHRGLESGDVVTLLGRDG
EETISPRTWAQLADSIPWEVLCSFKHRLPRLVI
Download sequence
Identical sequences Q0ID36
WP_011618375.1.57161 gi|113953241|ref|YP_729636.1| 64471.sync_0406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]