SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953250|ref|YP_731240.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953250|ref|YP_731240.1|
Domain Number 1 Region: 67-193
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 3.53e-30
Family L,D-transpeptidase catalytic domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953250|ref|YP_731240.1|
Sequence length 195
Comment ErfK/YbiS/YcfS/YnhG family protein [Synechococcus sp. CC9311]
Sequence
MRFFFRTVHTLRPVSLGCPLMGLKCTACVPGLPVALFASSLLVAAPALSRSQPTHLSMAV
RHPVEGRVVLDLGRRQISVVREGQTLGPWPVAIGDPRTPTPSGVFKVENMMMNPQYQSTK
SGKLHPKRGPQSPLGHRWIGFLRSGPNQFGIHGTPWPHWVKTRAAVSNGCVRMLNAHVQQ
LYDHVEVGMAVEIKR
Download sequence
Identical sequences Q0I8I2
64471.sync_2037 gi|113953250|ref|YP_731240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]