SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953298|ref|YP_731416.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953298|ref|YP_731416.1|
Domain Number 1 Region: 118-333
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.77e-57
Family BC ATP-binding domain-like 0.0000108
Further Details:      
 
Domain Number 2 Region: 15-116
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.32e-30
Family BC N-terminal domain-like 0.00011
Further Details:      
 
Domain Number 3 Region: 344-439
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 5.65e-24
Family BC C-terminal domain-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113953298|ref|YP_731416.1|
Sequence length 445
Comment phosphoribosylamine--glycine ligase [Synechococcus sp. CC9311]
Sequence
MSISTTRPLSLPPLRNVLVVGGGGREQALAWAFRRCPEIEGIWISPGNAGTGDLGGCTPL
AIAESDHEGMVAACSDHAIDLVVIGPEAPLADGLADTLRGQGFAVFGPSAEGAQLEASKA
WSKQLMQEAGIPTAGYWTVANEQEGIALLQQLQRPLVVKADGLAAGKGVTVADTVEETAA
AIQEAFQGRFGQAGERLVLEERLTGPEVSVFALCDGEDMVLLPPAQDHKRLMEGDQGPNT
GGMGAYAPAPLLDHAGLKQARELILEPTLAALRKRGIIYRGVIYAGLMLTAEGPQVIEFN
CRFGDPECQTLMPLMGPELARVLQACALGRLADAPPLTQVKLCSACVVAAAAGYPDSPRK
GDPIALELNPAPTTTDAIQLFHAGTRHSAEGVLETSGGRVLAMVAQSTDFDQAFAKAYEG
LSQIRYDGMQFRTDIGHQVRAPKLY
Download sequence
Identical sequences Q0I806
WP_011620128.1.57161 gi|113953298|ref|YP_731416.1| 64471.sync_2218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]