SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953300|ref|YP_729536.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953300|ref|YP_729536.1|
Domain Number 1 Region: 258-418
Classification Level Classification E-value
Superfamily CinA-like 5.23e-53
Family CinA-like 0.0000967
Further Details:      
 
Domain Number 2 Region: 10-213
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.96e-37
Family MoeA central domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953300|ref|YP_729536.1|
Sequence length 423
Comment CinA-like protein [Synechococcus sp. CC9311]
Sequence
MADRSERSGVEILCVGTELLLGNILNGNARWLSEELATLGLPHFRQTVVGDNRDRLIALV
QEIAQRSRVLIVTGGLGPTPDDLTTEAIAAAFSVPLEERVDVWSDIQEKARSRGRTPSPE
TRRQALLPVGAEVLWNPTGTAPGMIWTPVPGFSVLTFPGVPSEMKAMWKATAVPWFRSSG
LSKGVFVSRLLHFWGIGESTLAEQVADLLEGVNPTVAPYAGRGEVKLRITACADVSSKAW
VLVDQIEQELRQRTGNLCFGVDEDSLASVVLKRLGQTGQTLSVAESCTGGGLGAELTAVP
GASSVMLGGVISYSNAVKRDLLSVPEDLLTQHGAVSAQVAEAMALGVRRLTGSDWALSIT
GIAGPDGGTPEKPVGLVFVGVAGPDGCSTEMLRLGPTRGREWIRIVSAGEVLNRLRLRLM
VND
Download sequence
Identical sequences Q0IDD6
gi|113953300|ref|YP_729536.1| 64471.sync_0302 WP_011618281.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]