SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953318|ref|YP_729774.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953318|ref|YP_729774.1|
Domain Number 1 Region: 8-218
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.84e-70
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953318|ref|YP_729774.1|
Sequence length 218
Comment cytochrome b6 [Synechococcus sp. CC9311]
Sequence
MANSSPVYDWFQERLEIQDIADDFSTKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY
YKPTVAEAYSSVQYLMTDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT
WVTGVTMAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDFMVELLRGGESVGQ
STLTRFYSLHTFVMPWLLAVFMLMHFLMIRKQGISGPL
Download sequence
Identical sequences A0A0H4BIE7 G4FQ45 Q0ICP8
WP_006854932.1.28265 WP_006854932.1.44266 WP_006854932.1.57161 64471.sync_0549 gi|113953318|ref|YP_729774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]