SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953319|ref|YP_730929.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113953319|ref|YP_730929.1|
Domain Number - Region: 33-88
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0392
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113953319|ref|YP_730929.1|
Sequence length 182
Comment CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [Synechococcus sp. CC9311]
Sequence
MISPWRLWADRLTLARALMGLPLLLALALQYDALAWWLLLLGGWSDAADGWLARRADGGS
TWGARLDPLADKLLISAPLVWLASDGILPVWAVWLLLARELLISGWRGDSSDGAPASAAG
KAKTILQFLSLALMLWPPLWGDPALVQALKGVGVGLFWPSLLLALWSAWGYLKPCRSKPG
QR
Download sequence
Identical sequences Q0I9E3
gi|113953319|ref|YP_730929.1| 64471.sync_1725 WP_011619642.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]