SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953333|ref|YP_729587.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953333|ref|YP_729587.1|
Domain Number 1 Region: 158-424
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.2e-70
Family Extended AAA-ATPase domain 0.000000038
Further Details:      
 
Domain Number 2 Region: 412-606
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.05e-69
Family FtsH protease domain-like 0.00000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113953333|ref|YP_729587.1|
Sequence length 617
Comment cell division protein FtsH [Synechococcus sp. CC9311]
Sequence
MNKRWRNVGLYVLLVVVVIVVGTAFLDRPDPATAARTLRYSDFVESVQEDQVSRVLLSPD
RGTAQIVETDGRRAEVNLAPDKDLLKMLTDHNVDIAVQPSRQPGAWQQAATSLIFPLLLL
GGLFFLFRRAQGGGGGGGNQAMNFGKSKARVQMEPTTQVTFGDVAGIEGAKLELTEVVDF
LKNPDRFTAVGAKIPKGCLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGA
SRVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLTEMDGFEGNTG
IIIIAATNRPDVLDSALMRPGRFDRQVTVDRPDYAGRLQILGVHARSKTLSKDVDLDKVA
RRTPGYTGADLANLLNEAAILAARRQLTEVSNDEISDAIERIMVGPEKKDRVMSERRKRL
VAYHEAGHALVGALMPDYDAVQKISIIPRGNAGGLTFFTPSEERMESGLYSRTYLQNQMA
VALGGRVAEEIVYGEDEVTTGASNDLQQVASVARQMVTRFGMSDKLGPVALGRAQGGMFL
GRDIAAERDFSEDTAATIDSEVSDLVDVAYHRATKVLNDNRSVLDELAEMLVESETVDSQ
ELQDLLIRRDVRIAEYV
Download sequence
Identical sequences Q0ID85
WP_011618327.1.57161 gi|113953333|ref|YP_729587.1| 64471.sync_0355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]