SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953367|ref|YP_732085.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953367|ref|YP_732085.1|
Domain Number 1 Region: 157-318
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.06e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000158
Further Details:      
 
Domain Number 2 Region: 30-153
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.89e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.00018
Further Details:      
 
Domain Number 3 Region: 406-520
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.4e-27
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00015
Further Details:      
 
Domain Number 4 Region: 291-420
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0000000000000243
Family Duplicated SiR/NiR-like domains 1 and 3 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953367|ref|YP_732085.1|
Sequence length 530
Comment ferredoxin-nitrite reductase [Synechococcus sp. CC9311]
Sequence
MLEISLTDEFLYQGISTMSIQVPTRPFLENKKLNKIEQNKAAKDGLLVGNEIEEFARVGW
EEVDETDLQLRLKWYGMFWRPKTPGKFMLRLRVPNGVINHQQLRVVASIVERYGENGSCD
ITTRQNLQLRGVLLNDLPDILKRLKDVGLSSIQSGFDNPRNVTGNPLAGIDPNEIIDTRP
FTTELQDFLTNHCEGNPEFSNLPRKWNTAVAGAKDNFLLHNDIVFHPVERDGVLGFGVWI
GGILSSQMNAYAIPLNAWVKQDEICRMTDCVIRLWRDNGERNKRPKGRFRMYLDQLGIDA
FRSEVESLFGPLIEDPGSVFNSTPRSHYGIHPQKNADEFFAGLHVSVGRLTATDLHDLAT
ASLDYGTGEIRLTEDQNVIIVGLSSANLDRFKADPLLQRFPLEPGAIAAGTVSCTGNTYC
SFGLTNTKDQAIAAAKQLDAELELPEELKIHWTGCPNTCGQAFMGAIGLTGTKAKNSKGE
MGEGYTLSIGGSQGENPQIGEVQQKAIPAEDIQNVLRQVLIEQFGAKPRA
Download sequence
Identical sequences Q0I637
gi|113953367|ref|YP_732085.1| 64471.sync_2898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]