SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953373|ref|YP_729251.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953373|ref|YP_729251.1|
Domain Number 1 Region: 57-201
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000185
Family GAF domain 0.021
Further Details:      
 
Domain Number 2 Region: 239-455
Classification Level Classification E-value
Superfamily PP2C-like 0.00000811
Family PP2C-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953373|ref|YP_729251.1|
Sequence length 469
Comment SpoIIE domain-containing protein [Synechococcus sp. CC9311]
Sequence
MSSTPSWRHPASPQRGINQSLTATASLRQLLESMSREQRSNQELLVSLGFALRSFSNLNR
FLELVPVVAARLVGVQGSLLVPFQADGRLWRDQLHMLPGSRTEGMLRALAAHEPGNIIGF
GSDESLVRAMDRLVQRQLGSAGLFATSLIARGRPRGRLYVFNPSSPLAWSDVYRRHVQLV
ADLTGVAIENDLMLQEARRHERVDRQLSIGADIQAQLLPDHCPVIEGVDLAARCRPAFQV
GGDYYDFIPTRPELIGRRRERGRWAFVMGDVMGKGVPAGLLMTMLRGMLRAEVLSGLPPD
RILYDLNQLALEDLSQSHRFVTLFYSDFDPRTRRLRYANAAHNPPLIWRAQSRKLMRLDA
PGLLIGLQPEAEYGCESLVLEPGDVLLYYTDGVTEAPGITGDRFDEARLMRSLEQACRSG
TGSQGILDQLFSRLDRFVGPTRQLDDDASMVVLKVKEEIMLPSVPRSLA
Download sequence
Identical sequences Q0IE71
WP_011618003.1.57161 64471.sync_0012 gi|113953373|ref|YP_729251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]