SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953489|ref|YP_730413.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953489|ref|YP_730413.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.19e-103
Family BC ATP-binding domain-like 0.0000000107
Further Details:      
 
Domain Number 2 Region: 698-964
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.95e-97
Family BC ATP-binding domain-like 0.000000229
Further Details:      
 
Domain Number 3 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.73e-47
Family BC N-terminal domain-like 0.00000263
Further Details:      
 
Domain Number 4 Region: 396-549
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 3.27e-47
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00013
Further Details:      
 
Domain Number 5 Region: 574-700
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.17e-43
Family BC N-terminal domain-like 0.00000383
Further Details:      
 
Domain Number 6 Region: 967-1102
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 9.94e-39
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953489|ref|YP_730413.1|
Sequence length 1107
Comment carbamoyl phosphate synthase large subunit [Synechococcus sp. CC9311]
Sequence
MPRRNDLRRILLLGSGPIVIGQACEFDYSGTQACKALRAEGYEVILINSNPASIMTDPEM
ADRTYVEPLTPDVVTRVIELERPDALLPTMGGQTALNLAVALSKDGTLDRFGVELIGADL
KAIQKAEDRQLFKQAMERIGVHVCPSGIASTLEEAESVGASISSYPRIIRPAFTLGGSGG
GIAYNPEEFSAICKTGLDASPVSQILIEKSLLGWKEFELEVMRDLADNVVIVCSIENLDP
MGVHTGDSITVAPAQTLTDREYQRLRDQSIAIIREIGVATGGSNIQFAINPADGEVVVIE
MNPRVSRSSALASKATGFPIAKIAARLAIGYTLDEILNDITGKTPACFEPTIDYVVTKVP
RFAFEKFRGSPAVLTTAMKSVGEAMAIGRCFEESFQKALRSLETGLSGWGGDRPEPSCSK
TDLERSLRTPSPDRILAVRSAMLSGMTDAHIHELSHIDPWFLAKLRGLIDAESDLLKGKS
LEDLDETILFKLKTLGYSDRQIAWFVDSKELNVRERRDQLGVTPVFKTVDTCAAEFASST
PYHYSTYERPLFRLKPDGLLQPMAPSTEVATETRPKLMILGGGPNRIGQGIEFDYCCCHA
SFSAQDQGFATVMLNSNPETVSTDYDSSDRLYFEPITLEDVLNVIEAERPNGVIVQFGGQ
TPLKLALSLLNWLSTPQGKATGTQIWGTSPASIDLAEDREQFEAILRKLEIRQPRNGLAR
SEVEARSIAGNVGYPVVVRPSYVLGGRAMEVVYDEEELNRYMKEAVQVEPDHPVLIDQYL
ENAVEVDVDALCDHEGTVVIGGLMEHIEPAGIHSGDSACCLPSISLSEDALSLIRRWSEA
LAITLKVQGLINLQFAVQRAADGQEKVFIIEANPRASRTVPFVAKATGVPLARLATRLMA
GETLSQVGLLKEPVPPLQTVKEAVLPFRRFPGSDSLLGPEMRSTGEVMGSASDFGMAFAK
AELAAGEALPTTGTVFLSTHDRDKPALVPVARQLIGLGFQLMATSGTAQALRNEGLQVES
VLKVHEGRPNIEDLIRSGGVQLVINTPIGRQAAHDDRYLRRAALDYSVPTLTTLAGARAA
VEAIEALQTRTIVIHALQDVHASLSGQ
Download sequence
Identical sequences Q0IAV9
gi|113953489|ref|YP_730413.1| 64471.sync_1204 WP_011619134.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]