SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953514|ref|YP_731592.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953514|ref|YP_731592.1|
Domain Number 1 Region: 313-535
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-36
Family ABC transporter ATPase domain-like 0.00022
Further Details:      
 
Domain Number 2 Region: 81-297
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.7e-16
Family DNA repair protein MutS, domain III 0.011
Further Details:      
 
Domain Number 3 Region: 732-804
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000248
Family Smr domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953514|ref|YP_731592.1|
Sequence length 805
Comment MutS2 family protein [Synechococcus sp. CC9311]
Sequence
MTSEPRAISTPPSISILEETLELLEWPRLCQHFSTFASTPQGRQQCLKGQLPADLETTLT
YQARSMELASLDGLLDGGLSFQGVYDLEMVLLRCYKGGTASGEELLSVAHTLAAARRLRR
QIDDPDLRPRCSALLENVATLPELEQRLKFALEEGGRVANRASESLEDLRLQWQVARQER
RDRLQAVVRRWSTLLQDTVIAERHGRPVLAVKAGAASQCPGMVHDSSSSGNTVFVEPKTV
IGLGNRLAALDGRIRDEERRVLAELSAAVAEQNDVIDRLMAVLLKLDLALARGRYGQWLG
AVPPRLEAEADSPFHILELRHPLLVWQQRKEGGAPVVPVSVEVSEQLRVVAITGPNTGGK
TVTLKSIGLAALMARAGMWIPCNGSPSLPWCAQVLADIGDEQSLQQSLSTFSGHVKRIGS
ILQSIASGPAPALVLLDEVGAGTDPSEGTALAIALLRNLANCARLTIATTHFGELKALKY
SDSRFENASVSFDSDSLSPTYQLLWGIPGRSNALAIATRLGFDSGVIEQARQLLKPSGDG
DVNAVIRGLEEQRQRQQAAAEDAAALLARTELLHEELLQRWEQQRKNSAQQQELGRQRLE
SSIRDGQKEVRHLIRRLRDQKADGETARSAGQRLRKLESKHRSVPERRLHPEWRPSVGER
IRLLALDKAAEVLEVSDDGQQLSVRCGVMRSMVDLQSVESLDGRRAAPPEKPVVQVKARR
GSGGSQVRTARNTVDVRGQRVHEAEAAVEELLRGANGPIWVIHGIGTGRLKRGLRQWLDS
LPYVERVGDADQGDGGPGCSVVWVR
Download sequence
Identical sequences Q0I7I0
WP_011620301.1.57161 64471.sync_2396 gi|113953514|ref|YP_731592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]