SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953557|ref|YP_732115.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953557|ref|YP_732115.1|
Domain Number 1 Region: 175-398
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 2.35e-88
Family Argininosuccinate synthetase, C-terminal domain 0.00000137
Further Details:      
 
Domain Number 2 Region: 6-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.05e-43
Family N-type ATP pyrophosphatases 0.00000863
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953557|ref|YP_732115.1|
Sequence length 401
Comment argininosuccinate synthase [Synechococcus sp. CC9311]
Sequence
MGRATKVVLAYSGGVDTSVCIPYLKQEWGVEEVITFAADLGQGDELEPIRLKALEAGATQ
SLVGDLIKPFIEEFAFPAIRANALYEGRYPLSTALARPLIARRLVEVAREVGADAVAHGC
TGKGNDQVRFDVAIASLAPDLKVLTPAREWGMSREETIAYGERFGMPSPVSKKSPYSIDL
NLLGRSIEAGPLEDPMVAPPEEVFAMTRSVDQTPNDAEEIEIQFEGGNPVAINGKRLEPV
SLIREANLLAGTHGIGRLDMIENRVVGIKSREIYETPGLLLLIQAHQELESLTLAADVLR
TKRQLEMQWADLVYQGLWFGPLKEALDGFMDRTQIHVNGVVRLKLHKGNATVTGRASTDN
SLYIPEMASYGSEDKFDHRAAEGFIYVWGLPTRLWAAKHRR
Download sequence
Identical sequences Q0I607
64471.sync_2928 WP_011620815.1.57161 gi|113953557|ref|YP_732115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]