SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953677|ref|YP_731531.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953677|ref|YP_731531.1|
Domain Number 1 Region: 3-422
Classification Level Classification E-value
Superfamily L-aspartase-like 1.3e-124
Family L-aspartase/fumarase 0.00000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113953677|ref|YP_731531.1|
Sequence length 431
Comment adenylosuccinate lyase [Synechococcus sp. CC9311]
Sequence
MIERYTLPEMGEIWTDRAKYQSWLDVEVAACEANCRLGRVPKDAMQTIREQSAFEPERIL
EIEAEVRHDVIAFLTNVNEHVGDAGRYIHVGMTSSDVLDTGLALQLKASVVLLRKELRAL
DEAIAKLAAEHKATVMIGRSHAIHGEPITFGFKLAGWLAETRRNCERLARLERDVAVGQV
SGAMGTYANTDPEVEKLTCEILGLTPDTASTQVISRDRHADYVQILALVGASLDRFATEI
RNLQRTDVLEVEESFAKGQKGSSAMPHKRNPIRSERISGLARVLRSYVVAALENVALWHE
RDISHSSTERMMLPDCSVTLHFMLREMTAVISGLGVYPENMIRNMNVYGGVVFSQRVLLA
LVDGGMSREDAYEVVQRNAHSAWNTNGGDFRANLQSDPEVSNKLNADQLAECFSTQLHQA
NLGVVWDRLGL
Download sequence
Identical sequences Q0I7P1
gi|113953677|ref|YP_731531.1| WP_011620242.1.57161 64471.sync_2334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]