SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113953679|ref|YP_731421.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953679|ref|YP_731421.1|
Domain Number 1 Region: 18-118
Classification Level Classification E-value
Superfamily L21p-like 3.53e-35
Family Ribosomal protein L21p 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953679|ref|YP_731421.1|
Sequence length 125
Comment 50S ribosomal protein L21 [Synechococcus sp. CC9311]
Sequence
MAETSSSSSQTTPETGTYAIVEASGQQFWVQPNRYYDLDRLHADVDAKITLDKVLLVKNG
DAATIGKPYVQGASVELKVMAHRRGQKVIVYKMRPKKKTRRKNGHRQELTRVMVESISVG
GKAIS
Download sequence
Identical sequences Q0I801
gi|113953679|ref|YP_731421.1| WP_011620133.1.57161 64471.sync_2223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]