SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953740|ref|YP_729892.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113953740|ref|YP_729892.1|
Domain Number - Region: 14-72
Classification Level Classification E-value
Superfamily Clc chloride channel 0.00222
Family Clc chloride channel 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953740|ref|YP_729892.1|
Sequence length 81
Comment hypothetical protein sync_0674 [Synechococcus sp. CC9311]
Sequence
MQNQTNHHPQIPTYLVAVSSAFLVELFHLEYSGPFLVGHSFLVGLVVGLFGWLLAWGLWR
FWRVFPYKRWVKIRIKVYFNE
Download sequence
Identical sequences Q0ICD0
WP_011618619.1.57161 64471.sync_0674 gi|113953740|ref|YP_729892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]