SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953760|ref|YP_731509.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953760|ref|YP_731509.1|
Domain Number 1 Region: 2-200,232-314
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 3.4e-88
Family ATP synthase (F1-ATPase), gamma subunit 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113953760|ref|YP_731509.1|
Sequence length 317
Comment F0F1 ATP synthase subunit gamma [Synechococcus sp. CC9311]
Sequence
MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARLLENLQARM
RFEDADAPLLEQRAVQTITLMAVTGDRGLCGGYNSNIIKRTEKRFAELQRQGYKVALVLI
GRKAISYFTNRNYPIQATFTGLEQVPTADEAGSIASEIFAEFLSETSDRVEIIFTKFINL
VSCKPVVQTLLPLDPQGIAEADDEIFRLTTKEGRLSVEAGSAPENSQPALPSDIVFEQSP
DQLLNALLPLYLQNQLLRSLQESAASELASRMTAMNNASDNAKELAKTLTLDYNKARQAA
ITQEILEVVGGSAAAGA
Download sequence
Identical sequences Q0I7R3
gi|113953760|ref|YP_731509.1| WP_011620221.1.57161 64471.sync_2312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]