SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953790|ref|YP_731954.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953790|ref|YP_731954.1|
Domain Number 1 Region: 315-514
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.62e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000127
Further Details:      
 
Domain Number 2 Region: 892-1087
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.11e-40
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000161
Further Details:      
 
Domain Number 3 Region: 56-147
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.89e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00057
Further Details:      
 
Domain Number 4 Region: 156-199,293-347
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000000575
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0051
Further Details:      
 
Domain Number 5 Region: 201-289
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000327
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0023
Further Details:      
 
Domain Number 6 Region: 782-867
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000785
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0018
Further Details:      
 
Domain Number 7 Region: 735-781,869-917
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000152
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.017
Further Details:      
 
Domain Number 8 Region: 624-726
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000732
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953790|ref|YP_731954.1|
Sequence length 1105
Comment RND multidrug efflux transporter [Synechococcus sp. CC9311]
Sequence
MECQSKFSQIFQGSDPMSFADPFIKRPVLTSVCSIAIFIAGLVFVQTLPIEFVPDVAPSQ
IRISANYPGGNASIVEKSVTDQLEDLLSDTPGVDYLISSSTSNSSTIQMYLAPETSADTA
MLDAQNRIQKGLQNLPQVTQDQGVSVSQSTDTTLSGYMITSDQGQYDSAYLATLIEDNLK
KQIQLINGVGTVTIYPADSRFQVFLDPDLLKSYDLTAKEVSQKIISQNSPSSAGSVGAPY
LSDDASYSYPVLVKDGGYIQTVEEFENLAVRTSPSGALIRLKDIGKVEYISDPTFSLKTL
NGYPASYININQKSGSNAVQVARGIERVVDDFKKIAPPGIEVVQMQNQKSFILDSIENVT
DALGLAVILVLVTLVLFLKKWRTVLIPALAIPVAIVGTFLFLGLFGFTLNFLTLTGLVLA
TGLVVDDAILVVESVAKNMEAGMSPKQAAISTMNELSGAVVSTSLVLITLFLPVTLVASS
VGKIYQQFAVTIIFAIAISTFNALTFSPMMAGLILLPGDQKTASKWVTGIGGLIVGALFG
MFTRANFGDLIVPIAIAFFGVAGFYLTKVFQAFESLYSALENRFAVVLKYLIQNYVVVSA
CLVPAFMITFFLFNSTPTGLIPQEDTNILVGSMQLTSGSSLPATAKVAEQAASILQKDQQ
SKDSAIDNAVVIAGSGSTESITVFASLKPLEDRPLKLQGADAQQLALGAKLSSLPTAFPP
QLFQPPMINVAQNSSINMLLVDRSNRSYTFEELNEFAQRFRESAQKDSSIASIITTFAPD
SPAYELTINRSKLSSLGVDFDKAMSVLLELAGGSRVNQTSISGGVKDVQIISDSRGRREI
DDLLNYSVKSETTGEMVKIRQFAEAELISAPPSIDHFSFNRSVRFSIQPKAGFSQGQVIS
RLEKIFAESDFKNLDYEFDGLARTQVESGGQILMLFALAGLAVFLILSATYESYITSTTI
LLTVPLAILGSLVFVKMRSMDINIFSQVGLLMLIGLAAKNAILVVEFADQGMANGLEAAQ
AALEAAKSRLRPILMTSIASLAGFLPLVVARNAGANAQQSIGTVVFGGLLVGTILSLGVV
PSVYVFIKGLEARWFKHSLPDTSEN
Download sequence
Identical sequences Q0I6G8
gi|113953790|ref|YP_731954.1| 64471.sync_2766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]