SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953809|ref|YP_731904.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953809|ref|YP_731904.1|
Domain Number 1 Region: 68-166
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.07e-24
Family Pentapeptide repeats 0.0008
Further Details:      
 
Domain Number 2 Region: 167-235
Classification Level Classification E-value
Superfamily TPR-like 0.000000181
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953809|ref|YP_731904.1|
Sequence length 301
Comment hypothetical protein sync_2716 [Synechococcus sp. CC9311]
Sequence
MLDVPILPSHPSSRARRRPRSPIQRSTTKQAHVLNPSRLMPLLGLWLIASPLQAESVDDL
IKVLQEGDCRNCRLADADLVHADLRDADLRDARLQRANLGEAQLDGADLRGANLSFTSLR
GASLRGTNLEGSILHGTDLRFADLSGARLSPNALEKAHWQGATGISRDIRSHASLHNAGV
EASQSGRWPEAEKLFGAAILRSPQEPLSWVARGISRSELAKDDLAAQDFRYASALFKKGG
NQEVANQLQTVAEMVQTRRTKTQKKPEGKGWGGQLLGGVTATAQALAPLAIKALIPLGIG
F
Download sequence
Identical sequences Q0I6L8
WP_011620608.1.57161 gi|113953809|ref|YP_731904.1| 64471.sync_2716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]