SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953852|ref|YP_731930.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953852|ref|YP_731930.1|
Domain Number 1 Region: 72-349
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.67e-66
Family Alanine racemase-like, N-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 467-568
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00000942
Family Eukaryotic ODC-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113953852|ref|YP_731930.1|
Sequence length 644
Comment arginine decarboxylase [Synechococcus sp. CC9311]
Sequence
MVLADSITWTGSDSAQLYGLERWGDPYFSINPRGHVSVQPRGDRGGSLDLMELVAGLQDR
SLGLPLLIRFDDILEDRLERLHAAFERAVTRYDYEGRYQGVFPVKCNQQRHVVEELVTCG
RRWHFGLEAGSKAELLIALSLMDDPEALLICNGYKDQRYIETAILARRLGRRPVVVIEQP
DEVQRIIDASQELGAAPLIGIRARLSSRSTGRWGSSVGDKAKFGLPAPEIIGAVEALRDA
NLLSELRLLHFHVGSQINDIVVVKDALQEASRLYVELHALGAPMGYLDVGGGLGIDYDGS
RTATAASTNYSLQNYANDVVATVKEGCEPNNVPVPTLISESGRAIASHFSVLVFNVLGSG
GLQQPTPPIERDEPLIVRNLRETLQGIEALPTETPVDPSRLQEAWNDALKFKEDALAAFR
LGYLSLKERSMAEQLTWACARALLDRLHDVAKLPDDLKTLPAVLAETYYANLSIFRSAPD
TWAIQQLFPVMPLHRLNEQPTRLGHFADLTCDSDGKLNRFINDGQNKPLLELHQLKLNEP
YLIGMFLGGAYQEVMGNLHNLFGSTDAAHIRLAPGGDYQVDHVVRGDTNADVLEMMEHDP
DQLLERLRMASEKAISSGQLRISEARRLMDHLEISLHQSTYLQG
Download sequence
Identical sequences Q0I6J2
64471.sync_2742 gi|113953852|ref|YP_731930.1| WP_011620634.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]