SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953940|ref|YP_731920.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953940|ref|YP_731920.1|
Domain Number 1 Region: 144-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.1e-124
Family Enolase 0.0000000232
Further Details:      
 
Domain Number 2 Region: 8-141
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.62e-53
Family Enolase N-terminal domain-like 0.00000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113953940|ref|YP_731920.1|
Sequence length 430
Comment phosphopyruvate hydratase [Synechococcus sp. CC9311]
Sequence
MLDSLDLVIDTIVAREVLDSRGNPTVEAEVLLEGGASGRAIVPSGASTGAHEAHELRDGG
DRYMGKGVTKAVDHIEERIAPALCGLSALDQGSVDAAMLELDGSDNKSGLGANAILAVSM
ATARAAANGLGLPLYRYLGGPMATLLPVPLMNVINGGAHAANNLDFQEFMLVPHGAPNFR
EALRMGTEVFHTLKNLLSERGMSTSVGDEGGFAPDLGNEEAGEVLVQAIEKAGYKPGEQI
SLALDVASTEFYSDGRYAFSGGSYSSAEMVDQLEQLVNRFPIISIEDGLAEDDWEGWALL
TERLGKRVQLVGDDLFVTNTKRLQRGIDANTANSILIKVNQIGSLTETLQAIDLAGRSGY
TSVISHRSGETEDTTIADLAVATRAGQIKTGSLSRSERVAKYNQLLRIEDELGDQAVYAG
ATGQGPRGRD
Download sequence
Identical sequences Q0I6K2
gi|113953940|ref|YP_731920.1| 64471.sync_2732 WP_011620624.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]