SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113953967|ref|YP_730643.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113953967|ref|YP_730643.1|
Domain Number 1 Region: 228-430
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 2.21e-51
Family ATP-dependent DNA ligase catalytic domain 0.0025
Further Details:      
 
Domain Number 2 Region: 435-563
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.61e-26
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.002
Further Details:      
 
Domain Number 3 Region: 9-215
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.0000837
Family ATP-dependent DNA ligase DNA-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113953967|ref|YP_730643.1|
Sequence length 565
Comment ATP-dependent DNA ligase [Synechococcus sp. CC9311]
Sequence
MNQVNLKQFGELITAIDQSSGSNKKIDLISEFIRNIDPCDGCWTLSLLMNQGQKRLITGK
KLREILQASTSMPSWLFDDCFAQVGDSAETISLLWPQIKEENTNKTPKKSENDELLYTMT
KTAKPLHWWMETLLPSLKNKTETEQRNAVIELWMKIPDDNHYLLNKLITGGFRIGVSKGL
VVKSIARAYELNESTILERLMKSENITKKWFQDLVKPPMQNQSDRGAIPYPFYLASPVNL
IKLKETPINDWRLECKWDGIRGQLIRRENGIYLWSRGEELINESFPEIINMAENLPIGTV
LDGELLCWRDGSKQPMTFASLQRRIGRKRVTKTMLREYPVKFIAYDLIENESKDQRNIEL
RQRINLLEVIHKNHNHNDLIISEGKKITNWDQLSKTRDETIKEGAEGLMIKKIDSIYLSG
RKRGNWWKYKHDPMTLDVVLIYAQAGTGKRANLFTDYTFALWDTPNTAIGPRKLVTFAKA
YSGLDNNEIEHLDRWIRKNTKERFGPTRMVEQKQVFEIAFEGVMESKRHKSGLAVRFPRI
RRWRVDKIAEEADCLEQAQALCKRD
Download sequence
Identical sequences Q0IA79
gi|113953967|ref|YP_730643.1| 64471.sync_1438 WP_011619360.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]