SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954148|ref|YP_730755.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954148|ref|YP_730755.1|
Domain Number 1 Region: 105-254
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 7.46e-36
Family Aspartate/glutamate racemase 0.00025
Further Details:      
 
Domain Number 2 Region: 4-102
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 2.58e-28
Family Aspartate/glutamate racemase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113954148|ref|YP_730755.1|
Sequence length 263
Comment glutamate racemase [Synechococcus sp. CC9311]
Sequence
MTIRLGLFDSGIGGLTVLRRILERHGAVPVTYLGDTARVPYGSRSPSEIRSIAAEVVAWL
RAQQVSTVVMACNTTNALARDVTEGQAGVPVVGLIGAAAALVKESRVGVLATPATVASGA
YRESIEALHPGTLVVQQACPDFVPLIEAGDLRSDELREAAIRYLQPLLEASVDSVVLGCT
HYPLLVPLLANLLPSHMRLIDPAVAVATQLDAFLGQPLPGSQNQPVSLEAAHLCVTKDAQ
GFAERATAWLGQRPCVDLVNLQP
Download sequence
Identical sequences Q0I9W7
64471.sync_1550 gi|113954148|ref|YP_730755.1| WP_011619472.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]