SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954322|ref|YP_731392.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954322|ref|YP_731392.1|
Domain Number 1 Region: 130-464,493-568
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.22e-116
Family Amylase, catalytic domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 7-143
Classification Level Classification E-value
Superfamily E set domains 1.18e-32
Family E-set domains of sugar-utilizing enzymes 0.0078
Further Details:      
 
Domain Number 3 Region: 585-682
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.03e-19
Family alpha-Amylases, C-terminal beta-sheet domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113954322|ref|YP_731392.1|
Sequence length 691
Comment glycogen debranching protein [Synechococcus sp. CC9311]
Sequence
MSTIHRGSPWPLGSTITPRGVNFSVAAPTANRLELLIFSHPEAKTPEQVIELSEEHRSAD
YWHVEVEGVGAGCCYCYRVFGPIEPGGHGFRPAKVLVDPCARAIDGWNIYQRAAATGASP
NTDRCLKSVVCERDPFDFQAHPRPRHSWQETVIYELHIGGFTKRPDSGVSPDQRGTYLGV
IEKIPYLKELGVTTIELLPIQAFDPNDAPAGRDNVWGYSPLSWFAPHHEYATGSDPHSAR
DQVRDLVAACHDEGIEVLLDVVYNHTTEGNRNGPTLSWRGFADRNYYHQSDAGEYMDVSG
CGNSIAANDPLSRQLILESLRCWSNELGIDGFRFDLGIALSRGEKLKPLEHPPLFEAMEA
DPQLSELKLVSEPWDCGGLYRLSDFPAKRIGTWNGHFRDALRSFWKGDEGSTWPLGQRFR
GSPDLYNGKAASLGSSVNLITAHDGFSLLDLVSFNNKHNLANGENNRDGENHNNSWNHGV
EGPSSDRAIQTLRRRQQRNLLSTLLLSRGVPMLLMGDEVGRSQGGNNNTWCQDSPLSWMI
WGDDHCDHELQAYVQRLLNVRQQLAVLFNPIRPHIEKKPLRSNDSDELWRQWHGVELSKP
DWANWSHCLAMSLQQGHQGAVLWMGFNAYFKSMHFDLPEAASPWCRLIDTALPAGEDLPT
RIERWSPSGVPLEARSLVVMVAQEYADRLSL
Download sequence
Identical sequences Q0I830
gi|113954322|ref|YP_731392.1| 64471.sync_2193 WP_011620104.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]