SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954483|ref|YP_729337.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954483|ref|YP_729337.1|
Domain Number 1 Region: 304-501
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 9.16e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000484
Further Details:      
 
Domain Number 2 Region: 878-1072
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.06e-40
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 40-132
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.49e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00015
Further Details:      
 
Domain Number 4 Region: 611-715
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.99e-21
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00076
Further Details:      
 
Domain Number 5 Region: 139-184,280-334
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.09e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0084
Further Details:      
 
Domain Number 6 Region: 768-853
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000628
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0013
Further Details:      
 
Domain Number 7 Region: 185-276
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000144
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.001
Further Details:      
 
Domain Number 8 Region: 719-767,854-893
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000628
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113954483|ref|YP_729337.1|
Sequence length 1084
Comment acriflavin resistance protein acrF [Synechococcus sp. CC9311]
Sequence
MAFSDNFIKRPVLTTVCSILIVLVGMISIPMLPIAYLPNIADPLIQVIANYGGANAEVTE
QAVTNPLEQQINGVPGVSYISSNTDMTGNSTVNVYFDQSTDIDIDQVNVQNRVSLANPQL
PEQVSEVGVSVKQSNPSILLAYEVSSSKGQFDAAYLNGLVYEQLYYPLSRVEGVATVNII
GGATPAFWLFVDPNKLAANKLTSEDVINQVKSQNSVAVGGLVGGPPASGDQAFTYPIVVK
NNGNLISIDDFNNLILNRSPSGNLLKLKDVGEVRYGSNTFSAQAVDQNGHEALTIAVYQT
PASNALDVSEAVVDQINQFRSTLPPGVTIDQIYNIGQFIESSVDGVIDALGLAIVLVLII
LFLFLQNWRATVVPSLAIPISLVGTFAFLNVFGFSINQLTLLGLVLATGLVVDDAIVVIE
AVSTNIEKGMKPREAALACMGELFGALLATALVLMAVFVPVAFYPGGTGIIYKQFALTIA
FSVAISAFNALTFSPMLSGLILSQKKPPEPKGRSWIVVGVIVGLAFGRFSAASFGNWTYI
AGIVIGALAGSNLPLIFKVFNSNFERLETTYSKLLKRMIQARRIVLAGLVVGIVVTSFAF
TILPTAFIPDEDQGYGMGIFQLQNGASLVETKKLGMQIAKVLSEEDDVANASIINGFGFN
GSSPDQGIFFFGLQPLEERKGAEHSSDAIVDRLNAKLIQLSDGLAKASGPPAVPGFSPQG
GFYFQFNDLSNGTYSFNDLSNLSGQLIKTANASGDFSNVYTQFTPSAPAIGLNINREVMY
ALNVDFQEAMDTISALAGNNYSGITYESGQVRNIYVQGTPNQRQNIDDILSFYVRSKDGD
LVQVSQFAEAELSSAPPIISHYDLNRTVLIQGAEAIGKSSGQALSKIQQLFNAENYTNIG
SAFTGLAALQLSAGNASILVFGLGVLIVYLVLSAQYESYITPVIILATVPLAMLGALAFL
AIRSIDLNIYAQIGLVTLIGLAAKNGILIVEVAEQKLKEGKSTVIAVVESAESRLRPILM
TAIAALAGFLPLVVANGAGANAQQSLGTVIFGGLIVATVLSVGVVPPVYVLVKDLESRLL
SPRE
Download sequence
Identical sequences Q0IDY5
WP_011618087.1.57161 gi|113954483|ref|YP_729337.1| 64471.sync_0100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]