SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954501|ref|YP_730812.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954501|ref|YP_730812.1|
Domain Number 1 Region: 5-238
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.11e-58
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.00023
Further Details:      
 
Domain Number 2 Region: 249-337
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.00000419
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113954501|ref|YP_730812.1|
Sequence length 424
Comment UmuC protein [Synechococcus sp. CC9311]
Sequence
MTQVTALIDANNFYASCEQSLDPALIGRPVVVLSNNDGCIVARSAEARALGIAMGTPYFK
AKRHLEQHNVVIRSSNYALYADMSQRLMSLLESQVEDLEIYSIDEAFARLSRPSDGNLHP
WAQRLRTLARRNLGLPIAIGLGASKGQAKLANRLAKVVPAHAGFFDLGLCRDPDRWLETI
SIEDVWGIGRKLALWCRMRGVVNARELRDMPSGYLRAKAGVVGVRLQRELQGHACLPLDL
DPSPKQETCVSRSFSHPITSLEELREAVATYVVRAAEKLRKQHQRTAALTIYTRTSPFIP
GFYSRAASTSLDLPSNDTGVLLEAALPLVERIFQPHRALAKAGVLMQHLQGVDQLQQHLW
VPCTEEDQQRRERLMATVDRLNHRYGRGTVQWAACGLDPSWAMRRERLGRAATTRLSDVP
VVKA
Download sequence
Identical sequences Q0I9R0
WP_011619529.1.57161 64471.sync_1607 gi|113954501|ref|YP_730812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]