SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954533|ref|YP_732041.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954533|ref|YP_732041.1|
Domain Number 1 Region: 123-309,448-609
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.93e-103
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000951
Further Details:      
 
Domain Number 2 Region: 306-439
Classification Level Classification E-value
Superfamily GAD domain-like 1.62e-33
Family GAD domain 0.00088
Further Details:      
 
Domain Number 3 Region: 12-115
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.29e-31
Family Anticodon-binding domain 0.00008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113954533|ref|YP_732041.1|
Sequence length 622
Comment aspartyl-tRNA synthetase [Synechococcus sp. CC9311]
Sequence
MGNSPLSSETPMRSNGCGDLRDTHIDETVQLCGWVDRRRDHGGVIFIDLRDRSGTVQITV
DPDLGADAFAVAEHLRSETVLQVQGMVRARPDESLNDRLATGAVEVLASNIHVLNSVKGT
LPFPVSVHDEENTREELRLRHRFLDLRRKRMNDNLRLRAQTIQTARRFLEDEGFIEVETP
VLTRSTPEGARDYILPSRVCGGEWFALPQSPQLFKQLLMVGGIERYYQVARCFRDEDLRA
DRQPEFTQLDMEMSFMGQEQILELNERLIAAIWKTIKGIDLPLPFPRLTWHEAMERYGTD
RPDTRYGMELTNVSDIVKDMGFKVFSGAVKSGGSVKCIAVSGGNDAVSNVRIKPGGDVFS
EAQAAGAGGLAFIRVREGGEIDTIGAIKDNLSDEQKQTLLQRTGAEPGTLLLFGAGDTAT
VNKALDRVRQYLAKEMGLVKPDRENDQWNFLWVVDFPMFEFNKDENRLEALHHPFCAPNT
SDLGDKAEEWAKTLPTARAQAYDLVLNGLELGGGSLRIHDSALQREVLNSIGLAPEEAQE
QFGFLVDALDMGAPPHGGLAFGVDRMVMLLAGEDSIRDTIAFPKTQQARCLMTAAPAGVS
ERQLEDLHVASTWVDPMTENTD
Download sequence
Identical sequences Q0I681
64471.sync_2854 gi|113954533|ref|YP_732041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]