SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954562|ref|YP_730633.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954562|ref|YP_730633.1|
Domain Number 1 Region: 104-302
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.03e-47
Family BC ATP-binding domain-like 0.00049
Further Details:      
 
Domain Number 2 Region: 6-97
Classification Level Classification E-value
Superfamily PreATP-grasp domain 7.19e-18
Family BC N-terminal domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 308-368
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000651
Family BC C-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113954562|ref|YP_730633.1|
Sequence length 389
Comment phosphoribosylaminoimidazole carboxylase ATPase subunit [Synechococcus sp. CC9311]
Sequence
MPSVDNTIGVIGGGQLALMLGEAAQTRGLTLAVQASKAEDPAASLAKDLVIAGSTDARAT
RELSTYCAGITFENEWVAVDALMPLERQGVQFTPSLASLVPLVNKLSQRRLLDDLLIPSP
EWISLAELNPGSPSLPSGWTFPVMAKAAYGGYDGKGTRVVKDLNGLAQLLRNVDANEWLI
EAWVSYEQELALVVSRDSKGRIRSLPLAETHQKNQVCDWVIAPAAVSQLVEATAYNIAAS
LLTKLSYVGVMTLEFFYGSSGLFVNEVAPRTHNSGHFSIEACSSSQFDQQLCIAAGLDVP
NPDLIADGSLMVNLLGLSQDHAEPLEERLAKLRSMKELHLHWYGKDEIPGRKLGHVTTLL
KGHSAAERAEIGQQMLQSIREIWPLPLNW
Download sequence
Identical sequences Q0IA89
WP_011619350.1.57161 gi|113954562|ref|YP_730633.1| 64471.sync_1428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]