SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113954596|ref|YP_731754.1| from Synechococcus sp. CC9311

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113954596|ref|YP_731754.1|
Domain Number 1 Region: 11-267
Classification Level Classification E-value
Superfamily HemD-like 9.16e-67
Family HemD-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113954596|ref|YP_731754.1|
Sequence length 269
Comment uroporphyrinogen-III synthase [Synechococcus sp. CC9311]
Sequence
MSAGGSPDLQGRTIVVTRAREQLGEARKLLEQQGARVLDLPALEIGPPDEWGPLDDALAE
LDEFHWVIFSSANGVQAVDKRLRLQGSSLGQRPAGLRIGAVGRKTARLLDQLGAPADFVP
PDFVADSLIEHFPVSGWGLRLLLPRVQSGGRTLLAEAFGEAGARVVEVPAYESRCPANMP
ESTAKALASGEVDAITFSSGKTVLHTAALLEQTLGSETASRAINSIALVSIGPQTSQRCL
EQFGRVDQEANPHDLDGLTQACLQVMQTR
Download sequence
Identical sequences Q0I718
WP_011620459.1.57161 64471.sync_2565 gi|113954596|ref|YP_731754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]